Structure of PDB 5d4s Chain A

Receptor sequence
>5d4sA (length=70) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
EFMLPKYAQVKEEISSWINQGKILPDQKIPTENELMQQFGVSRHTIRKAI
GDLVSQGLLYSVQGGGTFVA
3D structure
PDB5d4s Plasticity in Repressor-DNA Interactions Neutralizes Loss of Symmetry in Bipartite Operators.
ChainA
Resolution1.972 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A P3 K4 Y5 S40 H42 T43 Q61 G62 P5 K6 Y7 S42 H44 T45 Q63 G64 PDBbind-CN: Kd=277nM
BS02 dna A T29 E30 R45 S59 Q61 G62 G64 T31 E32 R47 S61 Q63 G64 G66 PDBbind-CN: Kd=277nM
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5d4s, PDBe:5d4s, PDBj:5d4s
PDBsum5d4s
PubMed26511320
UniProtP96711|ARAR_BACSU Arabinose metabolism transcriptional repressor (Gene Name=araR)

[Back to BioLiP]