Structure of PDB 5d4r Chain A

Receptor sequence
>5d4rA (length=82) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
HLEVLFQGPLGSEFMLPKYAQVKEEISSWINQGKILPDQKIPTENELMQQ
FGVSRHTIRKAIGDLVSQGLLYSVQGGGTFVA
3D structure
PDB5d4r Plasticity in Repressor-DNA Interactions Neutralizes Loss of Symmetry in Bipartite Operators.
ChainA
Resolution2.07 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A P3 K4 Y5 S40 H42 T43 Q61 G62 G63 P17 K18 Y19 S54 H56 T57 Q75 G76 G77 PDBbind-CN: Kd=247.6nM
BS02 dna A L-4 T29 E30 R41 R45 Q61 G62 G64 L10 T43 E44 R55 R59 Q75 G76 G78 PDBbind-CN: Kd=247.6nM
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5d4r, PDBe:5d4r, PDBj:5d4r
PDBsum5d4r
PubMed26511320
UniProtP96711|ARAR_BACSU Arabinose metabolism transcriptional repressor (Gene Name=araR)

[Back to BioLiP]