Structure of PDB 5cub Chain A |
>5cubA (length=115) Species: 9606 (Homo sapiens) [Search protein sequence] |
SMSVKKPKRDDSKDLALCSMILTEMETHEDAWPFLLPVNLKLVPGYKKVI KKPMDFSTIREKLSSGQYPNLETFALDVRLVFDNCETFNEDDSDIGRAGH NMRKYFEKKWTDTFK |
|
PDB | 5cub Crystal structure of the second bromodomain of bromodomain adjancent to zinc finger domain protein 2B (BAZ2B) in complex with 314268-40-1 (SGC - Diamond I04-1 fragment screening) |
Chain | A |
Resolution | 2.1 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
54V |
A |
V1893 N1944 I1950 |
V38 N89 I95 |
|
|
|