Structure of PDB 5cs6 Chain A

Receptor sequence

>5cs6A (length=327) Species: 9606 (Homo sapiens)

SGPVPSRARVYTDVNTHRPSEYWDYESHVVEWGNQDDYQLVRKLGRGKYS
EVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIV
KDPVSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEILKALDYCHSMG
IMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPE
LLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGT
EDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDFL
DKLLRYDHQSRLTAREAMEHPYFYTVV

3D structure

• PDB: 5cs6 Specific inhibition of CK2 alpha from an anchor outside the active site.
• Chain: A
• Resolution: 1.88 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D156 K158 N161 D175 P184 S194
• Catalytic site (residue number reindexed from 1): D155 K157 N160 D174 P183 S193
• Enzyme Commision number: 2.7.11.1: non-specific serine/threonine protein kinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	K82	A	Y255 I258 D259 L265	Y254 I257 D258 L264	MOAD: Kd=630uM PDBbind-CN: -logKd/Ki=3.20,Kd=630uM BindingDB: IC50=3000000nM
BS02	K82	A	F121 P159 V162 I164 M225	F120 P158 V161 I163 M224	MOAD: Kd=630uM PDBbind-CN: -logKd/Ki=3.20,Kd=630uM BindingDB: IC50=3000000nM
BS03	K82	A	W24 H183 Q186	W23 H182 Q185	MOAD: Kd=630uM PDBbind-CN: -logKd/Ki=3.20,Kd=630uM BindingDB: IC50=3000000nM
BS04	K82	A	P295 E296	P294 E295	MOAD: Kd=630uM PDBbind-CN: -logKd/Ki=3.20,Kd=630uM BindingDB: IC50=3000000nM

Gene Ontology

Molecular Function

• GO:0004672 protein kinase activity
• GO:0004674 protein serine/threonine kinase activity
• GO:0005524 ATP binding

Biological Process

• GO:0006468 protein phosphorylation

External links

• PDB: RCSB:5cs6, PDBe:5cs6, PDBj:5cs6
• PDBsum: 5cs6
• PubMed: 28451126
• UniProt: P68400|CSK21_HUMAN Casein kinase II subunit alpha (Gene Name=CSNK2A1)