Structure of PDB 5cqx Chain A

Receptor sequence
>5cqxA (length=106) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
VSRYVPDMGDLIWVDFHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFE
VVLSGQEGVALADQVKSIAWRARGATKKGTVAPEELQLIKAKINVLIGLS
HHHHHH
3D structure
PDB5cqx Substrate Recognition and Activity Regulation of the Escherichia coli mRNA Endonuclease MazF.
ChainA
Resolution1.63 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.1.27.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A R29 T43 M45 P50 T52 K56 E61 L74 Q77 K79 I81 A82 R86 R18 T32 M34 P39 T41 K45 E50 L61 Q64 K66 I68 A69 R73
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003723 RNA binding
GO:0004519 endonuclease activity
GO:0004521 RNA endonuclease activity
GO:0005515 protein binding
GO:0042803 protein homodimerization activity
GO:0044877 protein-containing complex binding
GO:0140677 molecular function activator activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006402 mRNA catabolic process
GO:0006417 regulation of translation
GO:0009372 quorum sensing
GO:0016075 rRNA catabolic process
GO:0030308 negative regulation of cell growth
GO:0040008 regulation of growth
GO:0043068 positive regulation of programmed cell death
GO:0044010 single-species biofilm formation
GO:0051607 defense response to virus
Cellular Component
GO:0032991 protein-containing complex
GO:0110001 toxin-antitoxin complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5cqx, PDBe:5cqx, PDBj:5cqx
PDBsum5cqx
PubMed27026704
UniProtP0AE70|MAZF_ECOLI Endoribonuclease toxin MazF (Gene Name=mazF)

[Back to BioLiP]