Structure of PDB 5cq7 Chain A |
>5cq7A (length=115) Species: 9606 (Homo sapiens) [Search protein sequence] |
SMSVKKPKRDDSKDLALCSMILTEMETHEDAWPFLLPVNLKLVPGYKKVI KKPMDFSTIREKLSSGQYPNLETFALDVRLVFDNCETFNEDDSDIGRAGH NMRKYFEKKWTDTFK |
|
PDB | 5cq7 Crystal structure of the second bromodomain of bromodomain adjancent to zinc finger domain protein 2B (BAZ2B) in complex with N,N-dimethylquinoxaline-6-carboxamide (SGC - Diamond I04-1 fragment screening) |
Chain | A |
Resolution | 1.86 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
53G |
A |
P1888 V1898 N1944 |
P33 V43 N89 |
|
|
|