Structure of PDB 5cop Chain A |
>5copA (length=99) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] |
PQITLWQRPLVTIKIGGQLKEALLNTGADDTVLEEMSLPGRWKPKMIGGI GGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF |
|
PDB | 5cop C-5-Modified Tetrahydropyrano-Tetrahydofuran-Derived Protease Inhibitors (PIs) Exert Potent Inhibition of the Replication of HIV-1 Variants Highly Resistant to Various PIs, including Darunavir. |
Chain | A |
Resolution | 2.0 Å |
3D structure |
|
|
Catalytic site (original residue number in PDB) |
N25 T26 G27 |
Catalytic site (residue number reindexed from 1) |
N25 T26 G27 |
Enzyme Commision number |
? |
|
|
|
|