Structure of PDB 5ciz Chain A

Receptor sequence
>5cizA (length=203) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
TDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEG
KEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLI
QVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDA
MTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVY
GTR
3D structure
PDB5ciz The RNA Polymerase alpha Subunit Recognizes the DNA Shape of the Upstream Promoter Element
ChainA
Resolution5.0098 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A T168 R169 Q170 R180 E181 T162 R163 Q164 R174 E175
BS02 dna A D138 V139 C178 S179 E181 T182 R185 K201 D132 V133 C172 S173 E175 T176 R179 K195
BS03 CMP A V49 L61 I70 G71 E72 L73 R82 S83 A84 V86 T127 V43 L55 I64 G65 E66 L67 R76 S77 A78 V80 T121
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003680 minor groove of adenine-thymine-rich DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005515 protein binding
GO:0008301 DNA binding, bending
GO:0030552 cAMP binding
GO:0042802 identical protein binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006351 DNA-templated transcription
GO:0006355 regulation of DNA-templated transcription
GO:0045013 carbon catabolite repression of transcription
GO:0045892 negative regulation of DNA-templated transcription
GO:0045893 positive regulation of DNA-templated transcription
Cellular Component
GO:0005829 cytosol
GO:0032993 protein-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5ciz, PDBe:5ciz, PDBj:5ciz
PDBsum5ciz
PubMed
UniProtP0ACJ8|CRP_ECOLI DNA-binding transcriptional dual regulator CRP (Gene Name=crp)

[Back to BioLiP]