Structure of PDB 5ci9 Chain A

Receptor sequence

>5ci9A (length=116) Species: 9606 (Homo sapiens) [Search protein sequence]

HMQLEIQVALNFIISYLYNKLPRRRVNIFGEELERLLKKKYEGHWYPEKP
YKGSGFRCIHIGEKVDPVIEQASKESGLDIDDVRGNLPQDLSVWIDPFEV
SYQIGEKGPVKVLYVD

3D structure

PDB

5ci9 Structural basis for inhibition of the Tob-CNOT7 interaction by a fragment screening approach

Chain

Resolution

2.3 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	549	A	P49 F97	P50 F98
BS02	549	A	H59 K63	H60 K64

Gene Ontology

	Molecular Function
GO:0003714	transcription corepressor activity
GO:0005515	protein binding
GO:0030971	receptor tyrosine kinase binding
GO:0046332	SMAD binding

	Biological Process
GO:0008285	negative regulation of cell population proliferation
GO:0010468	regulation of gene expression
GO:0017148	negative regulation of translation
GO:0030514	negative regulation of BMP signaling pathway
GO:0045668	negative regulation of osteoblast differentiation
GO:0045892	negative regulation of DNA-templated transcription
GO:0060212	negative regulation of nuclear-transcribed mRNA poly(A) tail shortening
GO:0060213	positive regulation of nuclear-transcribed mRNA poly(A) tail shortening
GO:0060390	regulation of SMAD protein signal transduction
GO:1900153	positive regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay

External links

PDB	RCSB:5ci9, PDBe:5ci9, PDBj:5ci9
PDBsum	5ci9
PubMed	26518565
UniProt	P50616\|TOB1_HUMAN Protein Tob1 (Gene Name=TOB1)