Structure of PDB 5chz Chain A

Receptor sequence

>5chzA (length=140) Species: 9606 (Homo sapiens)

WTPPRSPFNLVQETLFHDPWKLLIATIFLNRTSGKMAIPVLWKFLEKYPS
AEVARTADWRDVSELLKPLGLYDLRAKTIVKFSDEYLTKQWKYPIELHGI
GKYGNDSYRIFCVNEWKQVHPEDHKLNKYHDWLWENHEKL

3D structure

• PDB: 5chz Structure of wild-type human MBD4 bound to a G:T mismatch
• Chain: A
• Resolution: 1.83 Å

Enzymatic activity

• Enzyme Commision number: 3.2.2.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	L447 V448 Q449 L466 R468 T469 S470 G471 Y540 D560 K562	L10 V11 Q12 L29 R31 T32 S33 G34 Y103 D123 K125
BS02	dna	A	R468 M473 K504 P505 G507 L508 Y509 D510 L511	R31 M36 K67 P68 G70 L71 Y72 D73 L74
BS03	dna	A	N467 R468 G536 I537 G538 Y540 D560	N30 R31 G99 I100 G101 Y103 D123
BS04	MG	A	I532 L534 I537	I95 L97 I100

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003824 catalytic activity

Biological Process

• GO:0006281 DNA repair
• GO:0006284 base-excision repair

External links

• PDB: RCSB:5chz, PDBe:5chz, PDBj:5chz
• PDBsum: 5chz
• UniProt: O95243|MBD4_HUMAN Methyl-CpG-binding domain protein 4 (Gene Name=MBD4)