Structure of PDB 5ce4 Chain A

Receptor sequence

>5ce4A (length=131) Species: 9606 (Homo sapiens)

VDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILT
LKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQ
ETTLVRELIDGKLILTLTHGTAVCTRTYEKE

3D structure

• PDB: 5ce4 High-resolution neutron and X-ray diffraction room-temperature studies of an H-FABP-oleic acid complex: study of the internal water cluster and ligand binding by a transferred multipolar electron-density distribution.
• Chain: A
• Resolution: 0.98 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	OLA	A	F16 V25 A33 P38 T53 F57 K58 A75 D76 L115 R126 Y128	F16 V25 A33 P38 T53 F57 K58 A75 D76 L115 R126 Y128

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0008092 cytoskeletal protein binding
• GO:0008289 lipid binding
• GO:0036041 long-chain fatty acid binding
• GO:0070538 oleic acid binding

Biological Process

• GO:0008285 negative regulation of cell population proliferation
• GO:0015909 long-chain fatty acid transport
• GO:0032365 intracellular lipid transport
• GO:0042632 cholesterol homeostasis
• GO:0046320 regulation of fatty acid oxidation
• GO:0050873 brown fat cell differentiation
• GO:0055091 phospholipid homeostasis
• GO:0071073 positive regulation of phospholipid biosynthetic process
• GO:0140214 positive regulation of long-chain fatty acid import into cell
• GO:2001245 regulation of phosphatidylcholine biosynthetic process

Cellular Component

• GO:0005615 extracellular space
• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:5ce4, PDBe:5ce4, PDBj:5ce4
• PDBsum: 5ce4
• PubMed: 27006775
• UniProt: P05413|FABPH_HUMAN Fatty acid-binding protein, heart (Gene Name=FABP3)