Structure of PDB 5cc8 Chain A

Receptor sequence

>5cc8A (length=296) Species: 525243 (Acinetobacter baumannii 6013150)

EFSIIDQYFNRQSHPDVALGIGDDSALITPPPNQQLVICADTLVAGRHFP
LETSPHAIGWKSVAVNLSDIAAMGAKPHSILLAISLPQVDHEWLEGFSQG
IYDCCNQFGVALIGGDTTQGPHLTITVTAMGWIETGKAVLRSGAKVGDYV
CVSGQIGDAAYGLQHLGHSLQQRLDYPTPRCKLGEELKGLASSMIDVSDG
LAQDLGHILKASKVGARLILEKLPVDPVLQQIEEQQRWQYALAGGDDYEL
CFTITPQNYEKLLQKQLDVKITMIGQIVEQTKLTFEHLGSDYPLQI

3D structure

• PDB: 5cc8 Crystal structures of thiamine monophosphate kinase from Acinetobacter baumannii in complex with substrates and products.
• Chain: A
• Resolution: 1.75 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ANP	A	I7 F11 I23 G24 D25 L84 G116 G117 D118 T119	I5 F9 I21 G22 D23 L82 G114 G115 D116 T117
BS02	MG	A	D43 D71	D41 D69
BS03	MG	A	D71 D198	D69 D196
BS04	ANP	A	D43 D71 S200 D201	D41 D69 S198 D199

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 16 19:03:49 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '5cc8', asym_id = 'A', title = 'Crystal structures of thiamine monophosphate kin...aumannii in complex with substrates and products.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='5cc8', asym_id='A', title='Crystal structures of thiamine monophosphate kin...aumannii in complex with substrates and products.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0009030,0009228', uniprot = '', pdbid = '5cc8', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0009030,0009228', uniprot='', pdbid='5cc8', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>