Structure of PDB 5cby Chain A

Receptor sequence
>5cbyA (length=76) Species: 32644 (unidentified) [Search protein sequence]
PPKICLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIID
KIRRKNCPACRFRKCLQAGMNLEARK
3D structure
PDB5cby Distal substitutions drive divergent DNA specificity among paralogous transcription factors through subdivision of conformational space.
ChainA
Resolution1.997 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 dna A C431 H432 Y433 K442 K446 C15 H16 Y17 K26 K30 PDBbind-CN: Kd=0.119uM
BS02 dna A S440 F444 R447 R470 K471 R477 S24 F28 R31 R54 K55 R61 PDBbind-CN: Kd=0.119uM
BS03 ZN A C421 C424 C438 C441 C5 C8 C22 C25
BS04 ZN A C457 C463 C473 C476 C41 C47 C57 C60
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:5cby, PDBe:5cby, PDBj:5cby
PDBsum5cby
PubMed26715749
UniProtP04150|GCR_HUMAN Glucocorticoid receptor (Gene Name=NR3C1)

[Back to BioLiP]