Structure of PDB 5c85 Chain A |
>5c85A (length=112) Species: 9606 (Homo sapiens) [Search protein sequence] |
MQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFT MKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGA VLRQARRQAEKM |
|
PDB | 5c85 Twenty Crystal Structures of Bromodomain and PHD Finger Containing Protein 1 (BRPF1)/Ligand Complexes Reveal Conserved Binding Motifs and Rare Interactions. |
Chain | A |
Resolution | 1.7 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
4YO |
A |
I652 V657 P658 F714 |
I25 V30 P31 F87 |
MOAD: Kd=105uM PDBbind-CN: -logKd/Ki=3.98,Kd=105uM BindingDB: Kd=105000nM |
|
|