Structure of PDB 5c17 Chain A |
>5c17A (length=206) Species: 1404 (Priestia megaterium) [Search protein sequence] |
KTELKKFYELLLAKLPKESVPILRTIFFSIRDGQAVTESSLINQTGINTK TVQSVVKILAQRQMIVREADQKIVGALGLSIIPTTNQIHLGGRTLFAWCA ISTLELSTALVADVDIHSRCAYTGEPIEVTVRNGKLAKTTPDSTVIWTVP FDSEAPWAGGTCKQIHYFSSVEHANKWKEEHPKLQGEIMTLEQALSFGNE LKKFLS |
|
PDB | 5c17 Structural and Biochemical Characterization of a Copper-Binding Mutant of the Organomercurial Lyase MerB: Insight into the Key Role of the Active Site Aspartic Acid in Hg-Carbon Bond Cleavage and Metal Binding Specificity. |
Chain | A |
Resolution | 1.24 Å |
3D structure |
|
|
Catalytic site (original residue number in PDB) |
C102 S105 C165 |
Catalytic site (residue number reindexed from 1) |
C99 S102 C162 |
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
HG |
A |
C102 C165 |
C99 C162 |
|
|
|
|