Structure of PDB 5bud Chain A

Receptor sequence

>5budA (length=391) Species: 237561 (Candida albicans SC5314) [Search protein sequence]

HMAKSLPLNSRSKTTALKQPRELFSYARDIDGKYVYDDPENSLSYYYLPD
STIDTGIDLQGGYSKFKKIPDEQNLADFNSLLKAIIKYETSEGKKISSDI
ITFREIMTKILSLPYNLTDPIDLYVVPFDGQLFIKSDDELDMKRRKEQEV
RMKQTNTVERYDYMKRCEYVGYKFETIATIPKPWSQVSRSQIENRNKKVV
NNYEQYLSVIRTGIGNVKLVLAGEIDCCWDYLPDEQNKKLNHYVELKTSR
IIENNSQVVSFEQKLFKAWCQCFLMGVTKIIYGFRDNNLILKNVELFNTE
EIPILIKNNPLTNAATEKKINCTNALKWYGAVVDWLNTTVDKKDEIKSYR
LKYDPVRKSFTLSETDSETNEKLRNGQLLTPEFTEWRQSLK

3D structure

PDB

5bud Structural and biochemical studies of the distinct activity profiles of Rai1 enzymes.

Chain

Resolution

1.99 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

3.6.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	A	R159 M163 C166 E167 G170 Y171 E244 K246 T247 R249 Q256 S259 K263 R284	R160 M164 C167 E168 G171 Y172 E245 K247 T248 R250 Q257 S260 K264 R285
BS02	MN	A	D225 E244 L245	D226 E245 L246
BS03	MN	A	E223 D225	E224 D226

Gene Ontology

	Molecular Function
GO:0000166	nucleotide binding
GO:0003723	RNA binding
GO:0004518	nuclease activity
GO:0030234	enzyme regulator activity
GO:0034353	mRNA 5'-diphosphatase activity
GO:0046872	metal ion binding
GO:0110152	RNA NAD+-cap (NAD+-forming) hydrolase activity
GO:1990174	phosphodiesterase decapping endonuclease activity

	Biological Process
GO:0000448	cleavage in ITS2 between 5.8S rRNA and LSU-rRNA of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000463	maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000466	maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000472	endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000480	endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000956	nuclear-transcribed mRNA catabolic process
GO:0006397	mRNA processing
GO:0030846	termination of RNA polymerase II transcription, poly(A)-coupled
GO:0031087	deadenylation-independent decapping of nuclear-transcribed mRNA
GO:0071035	nuclear polyadenylation-dependent rRNA catabolic process
GO:0110155	NAD-cap decapping
GO:1904595	positive regulation of termination of RNA polymerase II transcription

	Cellular Component
GO:0005634	nucleus
GO:0005829	cytosol
GO:0090730	Las1 complex
GO:0110103	RNA polymerase II termination complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5bud, PDBe:5bud, PDBj:5bud
PDBsum	5bud
PubMed	26101253
UniProt	Q5AAT0\|DXO_CANAL Decapping nuclease RAI1 (Gene Name=RAI1)

[Back to BioLiP]