Structure of PDB 5b78 Chain A

Receptor sequence

>5b78A (length=119) Species: 9606 (Homo sapiens)

SLPHEKDKPVAEPIPICDFCLGTKEQNREKKPEELISCADCGRSGHPSCL
KFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMEC
CDPPLTRMPKGMWICQICR

3D structure

• PDB: 5b78 Selective recognition of histone crotonylation by double PHD fingers of MOZ and DPF2
• Chain: A
• Resolution: 1.4 Å

Enzymatic activity

• Enzyme Commision number: 2.3.1.48: histone acetyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	D210 F211 L213 R235 S236 K243 I260 E261 A275 D276 M278 L279 F280 C281 D282 D285 P301 G303	D18 F19 L21 R43 S44 K51 I68 E69 A83 D84 M86 L87 F88 C89 D90 D93 P109 G111
BS02	ZN	A	C281 C284 C307 C310	C89 C92 C115 C118
BS03	ZN	A	C265 C268 H289 C292	C73 C76 H97 C100
BS04	ZN	A	C209 C212 H238 C241	C17 C20 H46 C49
BS05	ZN	A	C230 C233 C259 C262	C38 C41 C67 C70

External links

• PDB: RCSB:5b78, PDBe:5b78, PDBj:5b78
• PDBsum: 5b78
• PubMed: 27775714
• UniProt: Q92794|KAT6A_HUMAN Histone acetyltransferase KAT6A (Gene Name=KAT6A)