Structure of PDB 5b75 Chain A

Receptor sequence

>5b75A (length=119) Species: 9606 (Homo sapiens)

LPHEKDKPVAEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHPSCLK
FSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECC
DPPLTRMPKGMWICQICRP

3D structure

• PDB: 5b75 Selective recognition of histone crotonylation by double PHD fingers of MOZ and DPF2
• Chain: A
• Resolution: 1.704 Å

Enzymatic activity

• Enzyme Commision number: 2.3.1.48: histone acetyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	I208 S210 F211 L213 N235 S236 K243 W257 I260 E261 A275 D276 M278 L279 F280 C281 D282 D285 M300 P301 G303	I15 S17 F18 L20 N42 S43 K50 W64 I67 E68 A82 D83 M85 L86 F87 C88 D89 D92 M107 P108 G110
BS02	ZN	A	C281 C284 C307 C310	C88 C91 C114 C117
BS03	ZN	A	C265 C268 H289 C292	C72 C75 H96 C99
BS04	ZN	A	C209 C212 H238 C241	C16 C19 H45 C48
BS05	ZN	A	C230 C233 C259 C262	C37 C40 C66 C69

External links

• PDB: RCSB:5b75, PDBe:5b75, PDBj:5b75
• PDBsum: 5b75
• PubMed: 27775714
• UniProt: Q92794|KAT6A_HUMAN Histone acetyltransferase KAT6A (Gene Name=KAT6A)