Structure of PDB 5b4e Chain A

Receptor sequence

>5b4eA (length=303) Species: 262724 (Thermus thermophilus HB27)

VCKVCGQKAQVEMRSRGLALCREHYLDWFVKETERAIRRHRMLLPGERVL
VAVSGGKDSLALWDVLSRLGYQAVGLHIELGIGEYSKRSLEVTQAFARER
GLELLVVDLKEAYGFGVPELARLSGRVACSACGLSKRYIINQVAVEEGFR
VVATGHNLDDEAAVLFGNLLNPQEQGPVLPEKPGLAARVKPFYRFSEREV
LSYTLLRGIRYLHEECPNAKGAKSLLYKEALNLVERSMPGAKLRFLDGFL
EKIVALRECERCGYPTTGAVCAFCRMWDAVYRRAKKRKLLPEEVSFRPRV
KPL

3D structure

• PDB: 5b4e Biochemical and structural characterization of oxygen-sensitive 2-thiouridine synthesis catalyzed by an iron-sulfur protein TtuA
• Chain: A
• Resolution: 2.698 Å

Enzymatic activity

• Enzyme Commision number: 2.8.1.15: tRNA-5-methyluridine(54) 2-sulfurtransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	A	C3 C6 C22 H25	C2 C5 C21 H24
BS02	ZN	A	C274 C277 C286 C289	C259 C262 C271 C274
BS03	ANP	A	A53 V54 S55 G57 D59 S60 I79 G156 H157	A52 V53 S54 G56 D58 S59 I78 G155 H156
BS04	SF4	A	C130 C133 K137 C222 N224	C129 C132 K136 C216 N218

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0005524 ATP binding
• GO:0016740 transferase activity
• GO:0046872 metal ion binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0002098 tRNA wobble uridine modification
• GO:0002143 tRNA wobble position uridine thiolation
• GO:0008033 tRNA processing
• GO:0034227 tRNA thio-modification

Cellular Component

• GO:0002144 cytosolic tRNA wobble base thiouridylase complex

External links

• PDB: RCSB:5b4e, PDBe:5b4e, PDBj:5b4e
• PDBsum: 5b4e
• PubMed: 28439027
• UniProt: Q72LF3|TTUA_THET2 tRNA-5-methyluridine(54) 2-sulfurtransferase (Gene Name=ttuA)