Structure of PDB 5b40 Chain A

Receptor sequence
>5b40A (length=94) Species: 9606 (Homo sapiens) [Search protein sequence]
YRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVM
ALQEASEAYLVGLFEDTNLAAIHAKRVTIMPKDIQLARRIRGER
3D structure
PDB5b40 Monoubiquitination of histones H2B and H4 changes the nucleosome stability without affecting the nucleosome structure
ChainA
Resolution3.33 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A Y41 R42 P43 R63 R72 R83 F84 Q85 S86 V117 T118 Y1 R2 P3 R23 R32 R43 F44 Q45 S46 V77 T78
BS02 dna A Y41 P43 G44 T45 V46 A47 R49 R63 K64 L65 R69 R83 Y1 P3 G4 T5 V6 A7 R9 R23 K24 L25 R29 R43
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0006334 nucleosome assembly
Cellular Component
GO:0000786 nucleosome
GO:0005576 extracellular region
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5b40, PDBe:5b40, PDBj:5b40
PDBsum5b40
PubMed
UniProtQ71DI3|H32_HUMAN Histone H3.2 (Gene Name=H3C15)

[Back to BioLiP]