Structure of PDB 5b1m Chain A

Receptor sequence
>5b1mA (length=97) Species: 10090 (Mus musculus) [Search protein sequence]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
3D structure
PDB5b1m Testis-Specific Histone Variant H3t Gene Is Essential for Entry into Spermatogenesis
ChainA
Resolution2.34 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A Y41 R42 P43 T45 R72 R83 F84 Q85 R116 V117 T118 M120 Y4 R5 P6 T8 R35 R46 F47 Q48 R79 V80 T81 M83
BS02 dna A H39 R40 Y41 G44 V46 R49 R63 K64 L65 P66 R69 R83 H2 R3 Y4 G7 V9 R12 R26 K27 L28 P29 R32 R46
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5b1m, PDBe:5b1m, PDBj:5b1m
PDBsum5b1m
PubMed28099840
UniProtP68433|H31_MOUSE Histone H3.1 (Gene Name=H3c1)

[Back to BioLiP]