Structure of PDB 5aun Chain A |
>5aunA (length=136) Species: 69014 (Thermococcus kodakarensis KOD1) [Search protein sequence] |
MHEWALADAIVRTVLDYAQREGASRVKAVRVVLGELQDVAEDIVKFAMEQ LFAGTIAEGAEIEFVEEEAVFKCRNCNYEWKLKEVKDKFDERIKEDIHFI PEVVHAFLACPKCGSHDFEVVKGRGVYVAGIKIEKE |
|
PDB | 5aun Structural basis of a Ni acquisition cycle for [NiFe] hydrogenase by Ni-metallochaperone HypA and its enhancer |
Chain | A |
Resolution | 1.63 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
C73 C76 C110 C113 |
C73 C76 C110 C113 |
|
|
|
|