Structure of PDB 5aip Chain A |
>5aipA (length=141) Species: 491 (Neisseria meningitidis serogroup B) [Search protein sequence] |
MPTQSKHASINIGLIQAREALMTQFRPILNQANITDQQWRIIRLLAENGT LDFQDLANQACILRPSLTGILTRLEKAGLVVRLKPSNDQRRVFLKLTAEG EKLYEEIGEEVDERYDAIEEVLGREKMLLLKDLLAELAKIE |
|
PDB | 5aip Molecular Basis of Ligand-Dependent Regulation of Nadr, the Transcriptional Repressor of Meningococcal Virulence Factor Nada. |
Chain | A |
Resolution | 2.3 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
4HP |
A |
S9 N11 |
S9 N11 |
PDBbind-CN: -logKd/Ki=2.82,Kd=1.5mM |
|
|
|