Structure of PDB 5afk Chain A

Receptor sequence

>5afkA (length=205) Species: 6523,9606

GEFQRKLYKELVKNYNPDVIPTQRDRPVTVYFSLSLLQIMDVDEKNQVVD
VVFWLQMSWTDHYLQWNVSEYPGVKQVSVPISSLWVPDLAAYNAISKPEV
LTPQLALVNSSGHVQYLPSIRQRFSCDVSGVDTESGATCKLKFGSWTHHS
RELDLQMQEADISGYIPYSRFELVGVTQKRSERFYECCKEPYPDVTFTVT
FRKKG

3D structure

• PDB: 5afk Molecular Blueprint of Allosteric Binding Sites in a Homologue of the Agonist-Binding Domain of the Alpha7 Nicotinic Acetylcholine Receptor.
• Chain: A
• Resolution: 2.381 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	L0B	A	Y91 W145 Y184 C186 Y191	Y92 W146 Y185 C187 Y192
BS02	5VU	A	L6 Y7 L10 V11 L63 V76 S77 V78 S82	L7 Y8 L11 V12 L64 V77 S78 V79 S83	MOAD: ic50=132uM PDBbind-CN: -logKd/Ki=3.88,IC50=132uM
BS03	L0B	A	W53 Q114 L116	W54 Q115 L117
BS04	5VU	A	Q3 Q75 V76 S77 L104	Q4 Q76 V77 S78 L105	MOAD: ic50=132uM PDBbind-CN: -logKd/Ki=3.88,IC50=132uM

Gene Ontology

Molecular Function

• GO:0004888 transmembrane signaling receptor activity
• GO:0005216 monoatomic ion channel activity
• GO:0005230 extracellular ligand-gated monoatomic ion channel activity
• GO:0022848 acetylcholine-gated monoatomic cation-selective channel activity

Biological Process

• GO:0006811 monoatomic ion transport
• GO:0034220 monoatomic ion transmembrane transport

Cellular Component

• GO:0016020 membrane
• GO:0045211 postsynaptic membrane

External links

• PDB: RCSB:5afk, PDBe:5afk, PDBj:5afk
• PDBsum: 5afk
• PubMed: 25918415
• UniProt: P36544|ACHA7_HUMAN Neuronal acetylcholine receptor subunit alpha-7 (Gene Name=CHRNA7);
  P58154|ACHP_LYMST Acetylcholine-binding protein