Structure of PDB 5ab8 Chain A

Receptor sequence
>5ab8A (length=117) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence]
PISIYDKIGGHEAIEVVVEDFYVRVLADDQLSAFFSGTNMSRLKGKQVEF
FAAALGGPEPYTGAPMKQVHQGRGITMHHFSLVAGHLADALTAAGVPSET
ITEILGVIAPLAVDVTS
3D structure
PDB5ab8 The N-Terminal Pre-A Region of Mycobacterium Tuberculosis 2/2Hbn Promotes No-Dioxygenase Activity.
ChainA
Resolution1.53 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM A F45 F46 T49 L54 Q58 F61 Y72 G74 A75 M77 V80 H81 R84 I86 F91 V94 A123 F34 F35 T38 L43 Q47 F50 Y61 G63 A64 M66 V69 H70 R73 I75 F80 V83 A112
Gene Ontology
Molecular Function
GO:0005344 oxygen carrier activity
GO:0005515 protein binding
GO:0008379 thioredoxin peroxidase activity
GO:0008941 nitric oxide dioxygenase NAD(P)H activity
GO:0019825 oxygen binding
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0015671 oxygen transport
GO:0034599 cellular response to oxidative stress
GO:0045454 cell redox homeostasis
GO:0046210 nitric oxide catabolic process
GO:0051410 detoxification of nitrogen compound
GO:0098869 cellular oxidant detoxification
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5ab8, PDBe:5ab8, PDBj:5ab8
PDBsum5ab8
PubMed26499089
UniProtP9WN25|TRHBN_MYCTU Group 1 truncated hemoglobin GlbN (Gene Name=glbN)

[Back to BioLiP]