Structure of PDB 5aa9 Chain A

Receptor sequence

>5aa9A (length=295) Species: 9606 (Homo sapiens)

NPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVPLQVAVK
TLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLEFMA
GGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDI
AARNCLLTCPGPGRVAKIGDFGMARDIYRGGCAMLPVKWMPPEAFMEGIF
TSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPG
PVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIEY

3D structure

• PDB: 5aa9 Resensitization to Crizotinib by the Lorlatinib Alk Resistance Mutation L1198F.
• Chain: A
• Resolution: 1.93 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D1249 A1251 R1253 N1254 D1270 L1291
• Catalytic site (residue number reindexed from 1): D149 A151 R153 N154 D170 L185
• Enzyme Commision number: 2.7.10.1: receptor protein-tyrosine kinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	5P8	A	L1122 A1148 L1196 F1198 M1199 G1202 N1254 L1256 G1269 D1270 Y1401	L30 A48 L96 F98 M99 G102 N154 L156 G169 D170 Y295	MOAD: Ki=6.4nM PDBbind-CN: -logKd/Ki=8.19,Ki=6.4nM

Gene Ontology

Molecular Function

• GO:0004672 protein kinase activity
• GO:0004713 protein tyrosine kinase activity
• GO:0004714 transmembrane receptor protein tyrosine kinase activity
• GO:0005524 ATP binding

Biological Process

• GO:0006468 protein phosphorylation
• GO:0007169 cell surface receptor protein tyrosine kinase signaling pathway

Cellular Component

• GO:0016020 membrane

External links

• PDB: RCSB:5aa9, PDBe:5aa9, PDBj:5aa9
• PDBsum: 5aa9
• PubMed: 26698910
• UniProt: Q9UM73|ALK_HUMAN ALK tyrosine kinase receptor (Gene Name=ALK)