Structure of PDB 5aa4 Chain A

Receptor sequence

>5aa4A (length=418) Species: 1402513 (Pseudomonas aeruginosa BWHPSA013)

EGVLRVITRNSPATYFQDRNGETGFEYELAKRFAERLGVELKIETADNLD
DLYAQLSREGGPALAAAGLTPGREDDASVRYSHTYLDVTPQIIYRNGQQR
PTRPEDLVGKRIMVLKGSSHAEQLAELKKQYPELKYEESDAVEVVDLLRM
VDVGDIDLTLVDSNELAMNQVYFPNVRVAFDFGEARGLAWALPGGDDDSL
MNEVNAFLDQAKKEGLLQRLKDRYYGHVDVLGYVGAYTFAQHLQQRLPRY
ESHFKQSGKQKDTDWRLLAAIGYQESLWQPGATSKTGVRGLMMLTNRTAQ
AMGVSNRLDPKQSIQGGSKYFVQIRSELPESIKEPDRSWFALAAYNIGGA
HLEDARKMAEKEGLNPNKWLDVKKMLPRLAQKQWYAKTRYGYARGGETVH
FVQNVRRYYDILTWVTQP

3D structure

• PDB: 5aa4 Activation by Allostery in Cell-Wall Remodeling by a Modular Membrane-Bound Lytic Transglycosylase from Pseudomonas aeruginosa.
• Chain: A
• Resolution: 2.4 Å

Enzymatic activity

• Enzyme Commision number: 4.2.2.n1: peptidoglycan lytic exotransglycosylase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	6X4	A	R50 A54 F66 L90 Y94 G109 L110 T111 L127 V155 L156 S159 S160 H161 V185 L201 D203 N205 E206 M209 L229 Y266	R9 A13 F25 L49 Y53 G68 L69 T70 L86 V114 L115 S118 S119 H120 V144 L160 D162 N164 E165 M168 L188 Y225

Gene Ontology

Molecular Function

• GO:0008933 lytic transglycosylase activity
• GO:0016829 lyase activity
• GO:0016837 carbon-oxygen lyase activity, acting on polysaccharides

Biological Process

• GO:0000270 peptidoglycan metabolic process
• GO:0009253 peptidoglycan catabolic process
• GO:0016998 cell wall macromolecule catabolic process
• GO:0071555 cell wall organization

Cellular Component

• GO:0009279 cell outer membrane
• GO:0016020 membrane

External links

• PDB: RCSB:5aa4, PDBe:5aa4, PDBj:5aa4
• PDBsum: 5aa4
• PubMed: 27618662
• UniProt: A0A1I9GEN8