Structure of PDB 5a8a Chain A

Receptor sequence

>5a8aA (length=155) Species: 1697 (Corynebacterium ammoniagenes)

GRHFYVTGPVVRGAGRGGKELGFPTANQYFHDTVALPADGVYAGWLTILP
TEAPVSGNMEPEVAYAAAISVGTNPTFGDEQRSVESFVLDRDADLYGHDV
KVEFVDHVRAMEKFDSVEQLLEVMAKDVQKTRTLLAQDVQAHKMAPETYF
LQAES

3D structure

• PDB: 5a8a Structural Insights Into the Synthesis of Fmn in Prokaryotic Organisms.
• Chain: A
• Resolution: 1.8 Å

Enzymatic activity

• Enzyme Commision number: 2.7.1.26: riboflavin kinase.
  2.7.7.2: FAD synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FMN	A	G196 A197 R199 G200 T208 N210 V224 S253 N257 P258 T259 F260 E268 R292 M294 E295 L303 M307	G13 A14 R16 G17 T25 N27 V41 S70 N74 P75 T76 F77 E85 R109 M111 E112 L120 M124
BS02	ADP	A	G196 G198 G200 P207 T208 N210 V271 R274 D275 A276 L278 Y279	G13 G15 G17 P24 T25 N27 V88 R91 D92 A93 L95 Y96
BS03	MG	A	T208 N210	T25 N27
BS04	ZN	A	H186 D321 H325	H3 D138 H142

Gene Ontology

Molecular Function

• GO:0008531 riboflavin kinase activity

Biological Process

• GO:0009231 riboflavin biosynthetic process

External links

• PDB: RCSB:5a8a, PDBe:5a8a, PDBj:5a8a
• PDBsum: 5a8a
• PubMed: 26627660
• UniProt: Q59263|RIBF_CORAM Bifunctional riboflavin kinase/FMN adenylyltransferase (Gene Name=ribF)