Structure of PDB 5a77 Chain A

Receptor sequence
>5a77A (length=157) Species: 3077 (Chlorella vulgaris) [Search protein sequence]
NFHDQLKFAWLAGFVDADGCINAQIVSREDYLLKYQVRVSLTVFQSTTQH
FILLDIQKILGCGTVRKRNDGMSEFCVVGGTSLQTTLEKLLPYLQLKRAQ
AKLVLQIIKKLPNTKDPSVLMEAALLADKVGLLTDGKKRTILAENVRECL
KKLGHVV
3D structure
PDB5a77 Crystal Structure of the Homing Endonuclease I-Cvui Provides a New Template for Genome Modification
ChainA
Resolution2.5 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) A22 D23
Catalytic site (residue number reindexed from 1) A17 D18
Enzyme Commision number 3.1.-.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A D23 Q50 S51 M77 D18 Q45 S46 M72 PDBbind-CN: Kd=315nM
BS02 dna A D35 Y36 Q41 T69 R71 R73 N74 G84 K120 D30 Y31 Q36 T64 R66 R68 N69 G79 K115 PDBbind-CN: Kd=315nM
BS03 dna A A22 D23 G24 Q29 R33 R43 F49 R73 K102 T139 D140 G141 K143 R144 T145 I146 A17 D18 G19 Q24 R28 R38 F44 R68 K97 T134 D135 G136 K138 R139 T140 I141 PDBbind-CN: Kd=315nM
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
Biological Process
GO:0006314 intron homing
Cellular Component
GO:0009507 chloroplast

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5a77, PDBe:5a77, PDBj:5a77
PDBsum5a77
PubMed26363068
UniProtP56347|DNE1_CHLVU DNA endonuclease I-CvuI

[Back to BioLiP]