Structure of PDB 5a72 Chain A

Receptor sequence
>5a72A (length=157) Species: 3077 (Chlorella vulgaris) [Search protein sequence]
NFHDQLKFAWLAGFVDADGCINAQIVSREDYLLKYQVRVSLTVFQSTTQH
FILLDIQKILGCGTVRKRNDGMSEFCVVGGTSLQTTLEKLLPYLNLKRAQ
AKLVLQIIKKLPNTKDPSVLMEAALLADKVGLLTDGKKRTILAENVRECL
KKLGHVV
3D structure
PDB5a72 Crystal Structure of the Homing Endonuclease I-Cvui Provides a New Template for Genome Modification
ChainA
Resolution2.6 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) A22 D23
Catalytic site (residue number reindexed from 1) A17 D18
Enzyme Commision number 3.1.-.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A D23 C25 Q29 R43 F49 Q50 S51 R73 M77 T139 D140 G141 R144 T145 D18 C20 Q24 R38 F44 Q45 S46 R68 M72 T134 D135 G136 R139 T140 PDBbind-CN: Kd=53.3nM
BS02 dna A R33 D35 Y36 L37 Q41 R71 R73 N74 G84 K120 K142 K143 R28 D30 Y31 L32 Q36 R66 R68 N69 G79 K115 K137 K138 PDBbind-CN: Kd=53.3nM
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
Biological Process
GO:0006314 intron homing
Cellular Component
GO:0009507 chloroplast

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5a72, PDBe:5a72, PDBj:5a72
PDBsum5a72
PubMed26363068
UniProtP56347|DNE1_CHLVU DNA endonuclease I-CvuI

[Back to BioLiP]