Structure of PDB 5a2h Chain A

Receptor sequence
>5a2hA (length=147) Species: 3702 (Arabidopsis thaliana) [Search protein sequence]
DQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDM
INEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFIS
AAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK
3D structure
PDB5a2h Crystal Structure of Arabidopsis Thaliana Calmodulin7 and Insight Into its Mode of DNA Binding.
ChainA
Resolution2.27 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) V36
Catalytic site (residue number reindexed from 1) V34
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CA A D21 D23 D25 C27 E32 D19 D21 D23 C25 E30
BS02 CA A D57 D59 N61 T63 E68 D55 D57 N59 T61 E66
BS03 CA A D94 D96 N98 F100 E105 D92 D94 N96 F98 E103
BS04 CA A D130 D132 D134 Q136 E141 D128 D130 D132 Q134 E139
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0046872 metal ion binding
Biological Process
GO:0005513 detection of calcium ion
GO:0010099 regulation of photomorphogenesis
GO:0050832 defense response to fungus
Cellular Component
GO:0005634 nucleus
GO:0005829 cytosol
GO:0005886 plasma membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5a2h, PDBe:5a2h, PDBj:5a2h
PDBsum5a2h
PubMed27500568
UniProtP59220|CALM7_ARATH Calmodulin-7 (Gene Name=CAM7)

[Back to BioLiP]