Structure of PDB 5a0m Chain A

Receptor sequence

>5a0mA (length=224) Species: 4932 (Saccharomyces cerevisiae)

NIKKNQVMNLGPNSKLLKEYKSQLIELNIEQFEAGIGLILGDAYIRSRDE
GKTYCMQFEWKNKAYMDHVCLLYDQWVLSPPHKKERVNHLGNLVITWGAQ
TFKHQAFNKLANLFIVNNKKTIPNNLVENYLTPMSLAYWFMDDGGKWDYN
KNSTNKSIVLNTQSFTFEEVEYLVKGLRNKFQLNCYVKINKNKPIIYIDS
MSYLIFYNLIKPYLIPQMMYKLPN

3D structure

• PDB: 5a0m Structure of the I-Scei Nuclease Complexed with its DsDNA Target and Three Catalytic Metal Ions.
• Chain: A
• Resolution: 2.9 Å

Enzymatic activity

• Enzyme Commision number: 3.1.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	D344 W362 K363 N390 N394 V396 K493	D42 W60 K61 N88 N92 V94 K191
BS02	dna	A	P314 N315 K323 L380 S381 K386 R388 Q402 F404 K405 Q465 S466 K493	P12 N13 K21 L78 S79 K84 R86 Q100 F102 K103 Q163 S164 K191
BS03	dna	A	G313 N315 S316 K317 G343 D344 Y346 R348 R350 Q359 E361 K422 D445	G11 N13 S14 K15 G41 D42 Y44 R46 R48 Q57 E59 K120 D143
BS04	dna	A	D344 D444 D445 Y451 N452 N463	D42 D142 D143 Y149 N150 N161
BS05	MN	A	D344 D445	D42 D143
BS06	MN	A	G343 D445	G41 D143
BS07	MN	A	D344 D444	D42 D142

Gene Ontology

Molecular Function

• GO:0004519 endonuclease activity

Biological Process

• GO:0006314 intron homing
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing

Cellular Component

• GO:0005739 mitochondrion

External links

• PDB: RCSB:5a0m, PDBe:5a0m, PDBj:5a0m
• PDBsum: 5a0m
• PubMed: 27303901
• UniProt: P03882|SCE1_YEAST Intron-encoded endonuclease I-SceI (Gene Name=SCEI)