Structure of PDB 4zvs Chain A |
>4zvsA (length=139) Species: 9606 (Homo sapiens) [Search protein sequence] |
YQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFD VIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVT PIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQ |
|
PDB | 4zvs Reprogramming Caspase-7 Specificity by Regio-Specific Mutations and Selection Provides Alternate Solutions for Substrate Recognition. |
Chain | A |
Resolution | 2.5 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
A |
R87 H144 C186 |
R30 H87 C129 |
|
|
|
|