Structure of PDB 4zrv Chain A

Receptor sequence
>4zrvA (length=132) Species: 9913 (Bos taurus) [Search protein sequence]
ACPLKWFHFQSSCYLFSPDTMSWRASLKNCSSMGAHLVVINTQEEQEFLY
YTKPRKKEFYIGLTDQVTEGQWQWVDGTPFTKSLSFWDAGEPNNLVTVED
CATIRDSSNPRQNWNDVPCFFNMFRVCEMPER
3D structure
PDB4zrv Binding Sites for Acylated Trehalose Analogs of Glycolipid Ligands on an Extended Carbohydrate Recognition Domain of the Macrophage Receptor Mincle.
ChainA
Resolution2.095 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GLC A E135 R182 E58 R105
BS02 U8V A E168 N170 E176 R182 N192 E91 N93 E99 R105 N115
BS03 CA A E168 N170 E176 N192 D193 E91 N93 E99 N115 D116
BS04 CA A V116 N118 E122 E205 V39 N41 E45 E128
BS05 CA A D142 E146 N171 E176 D177 D65 E69 N94 E99 D100
External links