Structure of PDB 4zqq Chain A

Receptor sequence

>4zqqA (length=181) Species: 211044 (Influenza A virus (A/Puerto Rico/8/1934(H1N1)))

GPLGSMEDFVRQCFNPMIVELAEKTMKEYGEDLKIETNKFAAICTHLEVC
FMYSDASKHRFEIIEGRDRTMAWTVVNSICNTTGAEKPKFLPDLYDYKEN
RFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDE
ESRARIKTRLFTIRQEMASRGLWDSFRQSER

3D structure

• PDB: 4zqq Two Distinctive Binding Modes of Endonuclease Inhibitors to the N-Terminal Region of Influenza Virus Polymerase Acidic Subunit.
• Chain: A
• Resolution: 1.8 Å

Enzymatic activity

• Enzyme Commision number: 3.1.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MN	A	H41 D108 E119 I120	H46 D93 E104 I105
BS02	MN	A	E80 D108	E65 D93

Gene Ontology

Molecular Function

• GO:0003723 RNA binding

Biological Process

• GO:0039694 viral RNA genome replication

External links

• PDB: RCSB:4zqq, PDBe:4zqq, PDBj:4zqq
• PDBsum: 4zqq
• PubMed: 27088785
• UniProt: P03433|PA_I34A1 Polymerase acidic protein (Gene Name=PA)