Structure of PDB 4zqg Chain A

Receptor sequence

>4zqgA (length=408) Species: 480 (Moraxella catarrhalis)

LQSLAILGATGSIGDSTLAIIRQHPNRYRIHALTGFSRVDKLLALAMEFH
PVKICTSPDNYAQLSQKVTDAGLDTIILSGDEGLIEIASDEAVDTVVAAI
VGAAGLSSTLAAAGAGKRILLANKESLVMAGDLVIKTAKKHGATILPIDS
EHNAIYQCLPAAIQADNTAIHHTSYGIKKLWLTASGGSFLDKSIKQMQNA
SVKEAVNHPNWSMGQKISIDSATMMNKGLELIEACHLFDLKEHQIQVVIH
PNSVVHSLVEYVDGSFLAQLGTPDMKTPIAHALAYPERIKSGVMPLDLYQ
LGSLKFLAPDLDKFACLKLARYAARLGTGACIALNTANEIAVEAFLAEKI
CLTDIAVIVKACLDDKTIAQDYSQDFGDEVLGLERILTMDKKVRKIATAK
IKLLKQGD

3D structure

• PDB: 4zqg Crystal structures of the Moraxella catarrhalis DOX-P Reductoisomerase
• Chain: A
• Resolution: 2.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAD	A	G12 T14 G15 S16 I17 G39 F40 A103 I104 V105 A108 A126 N127 E129 D153 M217 G218 I221 M279	G8 T10 G11 S12 I13 G35 F36 A99 I100 V101 A104 A122 N123 E125 D149 M213 G214 I217 M275
BS02	MG	A	D153 E155 E234	D149 E151 E230
BS03	FOM	A	S154 E155 A188 S189 W215 S225 N230 K231	S150 E151 A184 S185 W211 S221 N226 K227

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 16 10:29:28 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4zqg', asym_id = 'A', title = 'Crystal structures of the Moraxella catarrhalis DOX-P Reductoisomerase'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4zqg', asym_id='A', title='Crystal structures of the Moraxella catarrhalis DOX-P Reductoisomerase')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0008299,0030604,0046872,0070402', uniprot = '', pdbid = '4zqg', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0008299,0030604,0046872,0070402', uniprot='', pdbid='4zqg', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>