Structure of PDB 4zpp Chain A

Receptor sequence

>4zppA (length=311) Species: 10090 (Mus musculus)

QLRYSVVEESEPGTLVGNVAQDLGLKGTDLLSRRLRLGSEENGRYFSLSL
VSGALAVSQKIDRESLCGASTSCLLPVQVVTEHPLELTRVEVEILDLNDN
SPSFATPDREMRISESAAPGARFPLDSAQDPDVGTNTVSFYTLSPNSHFS
LHVKTLKDGKLFPELVLEQQLDRETQARHQLVLTAVDGGTPARSGTSLIS
VIVLDVNDNAPTFQSSVLRVGLPENTPPGTLLLRLNATDPDEGTNGQLDY
SFGDHTSETVKNLFGLDPSSGAIHVLGPVDFEESNFYEIHARARDQGQPA
MEGHCVIQVDV

3D structure

• PDB: 4zpp Molecular Logic of Neuronal Self-Recognition through Protocadherin Domain Interactions.
• Chain: A
• Resolution: 3.002 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CA	A	N207 N209 D239 D241 N245 D295	N207 N209 D239 D241 N245 D295
BS02	CA	A	E115 D172 E174 D208	E115 D172 E174 D208
BS03	CA	A	E115 E174 D205 V206 D208 D241	E115 E174 D205 V206 D208 D241
BS04	CA	A	N98 N100 D130 D132 N136 D187	N98 N100 D130 D132 N136 D187
BS05	CA	A	E8 E64 D96 L97 D99 D132	E8 E64 D96 L97 D99 D132
BS06	CA	A	E8 E9 D62 E64 D99	E8 E9 D62 E64 D99
BS07	MAN	A	A192 S194	A192 S194

Gene Ontology

Molecular Function

• GO:0005509 calcium ion binding

Biological Process

• GO:0007155 cell adhesion
• GO:0007156 homophilic cell adhesion via plasma membrane adhesion molecules

Cellular Component

• GO:0005886 plasma membrane
• GO:0016020 membrane

External links

• PDB: RCSB:4zpp, PDBe:4zpp, PDBj:4zpp
• PDBsum: 4zpp
• PubMed: 26478182
• UniProt: Q91XW9