Structure of PDB 4zju Chain A

Receptor sequence
>4zjuA (length=260) Species: 470 (Acinetobacter baumannii) [Search protein sequence]
QGLLAGKRFLIAGVASKLSIAYGIAQALHREGAELAFTYPNEKLKKRVDE
FAEQFGSKLVFPCDVAVDAEIDNAFAELAKHWDGVDGVVHSIGFAPAHTL
DGDFTDVTDRDGFKIAHDISAYSFVAMARAAKPLLQARQGCLLTLTYQGS
ERVMPNYNVMGMAKASLEAGVRYLASSLGVDGIRVNAISAGPIRTLAASG
IKSFRKMLDANEKVAPLKRNVTIEEVGNAALFLCSPWASGITGEILYVDA
GFNTVGMSQS
3D structure
PDB4zju Structure of a NADH-dependent enoyl-ACP reductase from Acinetobacter baumannii in complex with NAD
ChainA
Resolution1.2 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 NAD A G15 A17 S21 I22 P42 D66 V67 S93 I94 G95 L147 T148 Y149 K166 A192 P194 I195 T197 G13 A15 S19 I20 P40 D64 V65 S91 I92 G93 L145 T146 Y147 K164 A190 P192 I193 T195
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Mon Mar 10 07:58:07 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4zju', asym_id = 'A', title = 'Structure of a NADH-dependent enoyl-ACP reductase from Acinetobacter baumannii in complex with NAD'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4zju', asym_id='A', title='Structure of a NADH-dependent enoyl-ACP reductase from Acinetobacter baumannii in complex with NAD')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0004318,0006633', uniprot = '', pdbid = '4zju', asym_id = 'A'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004318,0006633', uniprot='', pdbid='4zju', asym_id='A')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>