Structure of PDB 4zi8 Chain A

Receptor sequence

>4zi8A (length=313) Species: 10090 (Mus musculus) [Search protein sequence]

IIHYEILEERERGFPVGNVVTDLGLDLGSLSARRLRVVSGASRRFFEVNW
ETGEMFVNDRLDREELCGTLPSCTVTLELVVENPLELFSAEVVVQDINDN
NPSFPTGEMKLEISEALAPGTRFPLESAHDPDVGSNSLQTYELSHNEYFA
LRVQTREDGTKYAELVLERALDWEREPSVQLVLTALDGGTPARSATLPIR
ITVLDANDNAPAFNQSLYRARVREDAPPGTRVAQVLATDLDEGLNGEIVY
SFGSHNRAGVRELFALDLVTGVLTIKGRLDFEDTKLHEIYIQAKDKGANP
EGAHCKVLVEVVD

3D structure

PDB

4zi8 Structure and Sequence Analyses of Clustered Protocadherins Reveal Antiparallel Interactions that Mediate Homophilic Specificity.

Chain

Resolution

1.698 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CA	A	N208 N210 D240 D242 N246 D296	N207 N209 D239 D241 N245 D295
BS02	CA	A	E116 D173 E175 D209	E115 D172 E174 D208
BS03	CA	A	E116 E175 D206 A207 D209 D242	E115 E174 D205 A206 D208 D241
BS04	CA	A	E9 E10 D63 E65 D100	E8 E9 D62 E64 D99
BS05	CA	A	E9 E65 D97 I98 D100 D133	E8 E64 D96 I97 D99 D132
BS06	CA	A	N99 N101 D131 D133 N137 D188	N98 N100 D130 D132 N136 D187
BS07	CA	A	E225 E283	E224 E282
BS08	CA	A	E225 D314	E224 D313
BS09	CA	A	D281 E283	D280 E282

Gene Ontology

	Molecular Function
GO:0005509	calcium ion binding

	Biological Process
GO:0007155	cell adhesion
GO:0007156	homophilic cell adhesion via plasma membrane adhesion molecules

	Cellular Component
GO:0005886	plasma membrane
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4zi8, PDBe:4zi8, PDBj:4zi8
PDBsum	4zi8
PubMed	26481813
UniProt	Q91XX1

[Back to BioLiP]