Structure of PDB 4zhz Chain A

Receptor sequence

>4zhzA (length=181) Species: 211044 (Influenza A virus (A/Puerto Rico/8/1934(H1N1)))

GPLGSMEDFVRQCFNPMIVELAEKTMKEYGEDLKIETNKFAAICTHLEVC
FMYSDASKHRFEIIEGRDRTMAWTVVNSICNTTGAEKPKFLPDLYDYKEN
RFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDE
ESRARIKTRLFTIRQEMASRGLWDSFRQSER

3D structure

• PDB: 4zhz Two Distinctive Binding Modes of Endonuclease Inhibitors to the N-Terminal Region of Influenza Virus Polymerase Acidic Subunit
• Chain: A
• Resolution: 2.5 Å

Enzymatic activity

• Enzyme Commision number: 3.1.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	4P8	A	Y24 I38 H41 E80 Y130 K134	Y29 I43 H46 E65 Y115 K119	BindingDB: IC50=63000nM
BS02	4P8	A	K34 Y130 K137	K39 Y115 K122	BindingDB: IC50=63000nM
BS03	MN	A	E80 D108 E119	E65 D93 E104

Gene Ontology

Molecular Function

• GO:0003723 RNA binding

Biological Process

• GO:0039694 viral RNA genome replication

External links

• PDB: RCSB:4zhz, PDBe:4zhz, PDBj:4zhz
• PDBsum: 4zhz
• PubMed: 27088785
• UniProt: P03433|PA_I34A1 Polymerase acidic protein (Gene Name=PA)