Structure of PDB 4zdc Chain A

Receptor sequence

>4zdcA (length=267) Species: 4932 (Saccharomyces cerevisiae)

EIRQNEKISYRIEGPFFIIHLINPDNLNALEGEDYIYLGELLELADRNRD
VYFTIIQSSGRFFSSGADFKGIAKAQGDDTNKYPSETSKWVSNFVARNVY
VTDAFIKHSKVLICCLNGPAIGLSAALVALCDIVYSINDKVYLLYPFANL
GLITEGGTTVSLPLKFGTNTTYECLMFNKPFKYDIMCENGFISKNFNMPS
SNAEAFNAKVLEELREKVKGLYLPSCLGMKKLLKSNHIDAFNKANSVEVN
ESLKYWVDGEPLKRFRQ

3D structure

• PDB: 4zdc Structures of yeast peroxisomal Delta (3), Delta (2)-enoyl-CoA isomerase complexed with acyl-CoA substrate analogues: the importance of hydrogen-bond networks for the reactivity of the catalytic base and the oxyanion hole.
• Chain: A
• Resolution: 2.13 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): A70 N101 L126 A129 F150 E158
• Catalytic site (residue number reindexed from 1): A67 N98 L123 A126 F147 E155
• Enzyme Commision number: 5.3.3.8: Delta(3)-Delta(2)-enoyl-CoA isomerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CO8	A	N29 L30 A32 S68 G69 A70 D71 F72 K73 F97 N101 I124 G125 L126 E158	N26 L27 A29 S65 G66 A67 D68 F69 K70 F94 N98 I121 G122 L123 E155

Gene Ontology

Molecular Function

• GO:0004165 delta(3)-delta(2)-enoyl-CoA isomerase activity
• GO:0016853 isomerase activity

Biological Process

• GO:0006631 fatty acid metabolic process
• GO:0006635 fatty acid beta-oxidation

Cellular Component

• GO:0005777 peroxisome
• GO:0005782 peroxisomal matrix

External links

• PDB: RCSB:4zdc, PDBe:4zdc, PDBj:4zdc
• PDBsum: 4zdc
• PubMed: 26527136
• UniProt: Q05871|ECI1_YEAST 3,2-trans-enoyl-CoA isomerase (Gene Name=ECI1)