Structure of PDB 4zcd Chain A

Receptor sequence

>4zcdA (length=323) Species: 264730 (Pseudomonas savastanoi pv. phaseolicola 1448A)

VPIAIIGTGIAGLSAAQALTSAGHQVHLFDKSRGSGGRMSSKRSDAGSLD
MGAQYFTARDRRFATAVKQWQAQGHVSEWTPLLYNFHGGRLSPSPDEQVR
WVGEPGMSAITRAMRGDLPVSFSCRITDVFRGEQHWNLLDAESENHGPFS
HVIIATPAPQATALLAAAPKLASVVAGVKMDPTWAVALAFETPLQTPMQG
CFVQDSPLDWLARNRSKPGRLDSWVLHATSQWSRQNLDASREQVIEHLHG
AFAELIDCAMPAPVFSLAHRWLYARPAGSHEWGALSDADLGIYVCGDWCL
SGRVEGAWLSGQEAARRLLEHLQ

3D structure

• PDB: 4zcd Bacterial Renalase: Structure and Kinetics of an Enzyme with 2- and 6-Dihydro-beta-NAD(P) Oxidase Activity from Pseudomonas phaseolicola.
• Chain: A
• Resolution: 1.6605 Å

Enzymatic activity

• Enzyme Commision number: 1.6.3.5: renalase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	A	I8 G9 G11 A13 D32 K33 G39 R40 G54 A55 Y57 I128 T158 P159 H232 W276 A279 G301 D302 R308 V309	I6 G7 G9 A11 D30 K31 G37 R38 G52 A53 Y55 I126 T156 P157 H227 W271 A274 G296 D297 R303 V304
BS02	NAD	A	Y57 T59 R61 N87 S96 D98 R102 T185 F204 R280 G307 R308	Y55 T57 R59 N85 S94 D96 R100 T183 F202 R275 G302 R303

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0016491 oxidoreductase activity
• GO:0050660 flavin adenine dinucleotide binding
• GO:0050661 NADP binding
• GO:0050664 oxidoreductase activity, acting on NAD(P)H, oxygen as acceptor
• GO:0051287 NAD binding
• GO:0071949 FAD binding

External links

• PDB: RCSB:4zcd, PDBe:4zcd, PDBj:4zcd
• PDBsum: 4zcd
• PubMed: 26016690
• UniProt: Q48MT7|RNLS_PSE14 Renalase (Gene Name=PSPPH_1014)