Structure of PDB 4z9b Chain A

Receptor sequence

>4z9bA (length=157) Species: 9606 (Homo sapiens)

HMEFTKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYE
IGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLN
RKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCR
AFLEKAH

3D structure

• PDB: 4z9b Crystal structures of the apo form and a complex of human LMW-PTP with a phosphonic acid provide new evidence of a secondary site potentially related to the anchorage of natural substrates.
• Chain: A
• Resolution: 2.41 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): C12 N15 C17 R18 S19 D129
• Catalytic site (residue number reindexed from 1): C12 N15 C17 R18 S19 D129
• Enzyme Commision number: 3.1.3.2: acid phosphatase.
  3.1.3.48: protein-tyrosine-phosphatase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	B85	A	C12 L13 G14 I16 C17 R18 E50 D129	C12 L13 G14 I16 C17 R18 E50 D129

Gene Ontology

Molecular Function

• GO:0003993 acid phosphatase activity
• GO:0004721 phosphoprotein phosphatase activity
• GO:0004725 protein tyrosine phosphatase activity
• GO:0004726 non-membrane spanning protein tyrosine phosphatase activity
• GO:0005515 protein binding
• GO:0016791 phosphatase activity

Biological Process

• GO:0006470 protein dephosphorylation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0009898 cytoplasmic side of plasma membrane
• GO:0042383 sarcolemma
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:4z9b, PDBe:4z9b, PDBj:4z9b
• PDBsum: 4z9b
• PubMed: 26117648
• UniProt: P24666|PPAC_HUMAN Low molecular weight phosphotyrosine protein phosphatase (Gene Name=ACP1)