Structure of PDB 4z82 Chain A

Receptor sequence

>4z82A (length=186) Species: 10116 (Rattus norvegicus)

ELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFD
QYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKE
TLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSL
HLYSPPFDTSHAFDQRTGHKNKVTMTFHSKFGIRTP

3D structure

• PDB: 4z82 Influence of cysteine 164 on active site structure in rat cysteine dioxygenase.
• Chain: A
• Resolution: 1.7 Å

Enzymatic activity

• Enzyme Commision number: 1.13.11.20: cysteine dioxygenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FE2	A	H86 H88 H140	H82 H84 H136
BS02	CYS	A	Y58 R60 H86 H88 H155 Y157 M179	Y54 R56 H82 H84 H151 Y153 M175

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0008198 ferrous iron binding
• GO:0008270 zinc ion binding
• GO:0016151 nickel cation binding
• GO:0016702 oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen
• GO:0017172 cysteine dioxygenase activity
• GO:0046872 metal ion binding
• GO:0051213 dioxygenase activity

Biological Process

• GO:0006534 cysteine metabolic process
• GO:0007595 lactation
• GO:0019448 L-cysteine catabolic process
• GO:0033762 response to glucagon
• GO:0042412 taurine biosynthetic process
• GO:0043200 response to amino acid
• GO:0045471 response to ethanol
• GO:0046439 L-cysteine metabolic process
• GO:0051384 response to glucocorticoid
• GO:0051591 response to cAMP

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:4z82, PDBe:4z82, PDBj:4z82
• PDBsum: 4z82
• PubMed: 27193596
• UniProt: P21816|CDO1_RAT Cysteine dioxygenase type 1 (Gene Name=Cdo1)