Structure of PDB 4z66 Chain A

Receptor sequence
>4z66A (length=98) Species: 8355 (Xenopus laevis) [Search protein sequence]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
3D structure
PDB4z66 Histone Acetylation near the Nucleosome Dyad Axis Enhances Nucleosome Disassembly by RSC and SWI/SNF.
ChainA
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A R442 T445 R463 R472 R483 F484 Q485 R516 V517 T518 R5 T8 R26 R35 R46 F47 Q48 R79 V80 T81
BS02 dna A R440 Y441 P443 G444 V446 A447 R449 R463 L465 R469 R483 R3 Y4 P6 G7 V9 A10 R12 R26 L28 R32 R46
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:4z66, PDBe:4z66, PDBj:4z66
PDBsum4z66
PubMed26416878
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]