Structure of PDB 4z02 Chain A |
>4z02A (length=119) Species: 9606 (Homo sapiens) [Search protein sequence] |
PLKVVWAKCSGYPSYPALIIDPKMPRVPGHHNGVTIPAPPLDVLKIGEHM QTKSDEKLFLVLFFDNKRSWQWLPKSKMVPLGIDETIDKLKMMEGRNSSI RKAVRIAFDRAMNHLSRVH |
|
PDB | 4z02 Crystal structure of BRD1 incomplex with Isoquinoline-3-carboxylic acid |
Chain | A |
Resolution | 1.87 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
4K8 |
A |
Y943 F991 S997 Q999 |
Y15 F63 S69 Q71 |
|
|
|