Structure of PDB 4yyl Chain A

Receptor sequence
>4yylA (length=181) Species: 211044 (Influenza A virus (A/Puerto Rico/8/1934(H1N1))) [Search protein sequence]
GPLGSMEDFVRQCFNPMIVELAEKTMKEYGEDLKIETNKFAAICTHLEVC
FMYSDASKHRFEIIEGRDRTMAWTVVNSICNTTGAEKPKFLPDLYDYKEN
RFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDE
ESRARIKTRLFTIRQEMASRGLWDSFRQSER
3D structure
PDB4yyl Structural and computational study on inhibitory compounds for endonuclease activity of influenza virus polymerase
ChainA
Resolution1.905 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.1.-.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 4KN A Y24 H41 E80 R84 D108 E119 K134 Y29 H46 E65 R69 D93 E104 K119 MOAD: ic50=9.7uM
PDBbind-CN: -logKd/Ki=5.01,IC50=9.7uM
BindingDB: IC50=9700nM
BS02 4KN A T20 K34 A37 I38 H41 G121 V122 Y130 T25 K39 A42 I43 H46 G106 V107 Y115 MOAD: ic50=9.7uM
PDBbind-CN: -logKd/Ki=5.01,IC50=9.7uM
BindingDB: IC50=9700nM
BS03 4KN A E31 K34 A37 F191 S194 E195 E36 K39 A42 F176 S179 E180 MOAD: ic50=9.7uM
PDBbind-CN: -logKd/Ki=5.01,IC50=9.7uM
BindingDB: IC50=9700nM
BS04 MN A H41 D108 E119 I120 H46 D93 E104 I105
BS05 MN A E80 D108 E65 D93
Gene Ontology
Biological Process
GO:0039694 viral RNA genome replication

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4yyl, PDBe:4yyl, PDBj:4yyl
PDBsum4yyl
PubMed26252962
UniProtP03433|PA_I34A1 Polymerase acidic protein (Gene Name=PA)

[Back to BioLiP]