Structure of PDB 4yry Chain A

Receptor sequence

>4yryA (length=276) Species: 2336 (Thermotoga maritima)

MGGTALNEIVKKVKIAEDVFDFWIHSPSVSKEARPGQFVVIRLHEKGERI
PLTVADTKPEEGLFRMVVKVVGKTTHELSLKKEGDTILDVVGPLGNPSEI
ENYGNVLLVGGGVGIATLYPIAKALKEAGNNITTVLGARTKDYLIMVDEF
KEISDVLLVTDDGSAGMKGVVTDAMDKLFRERKFDICWAVGPTIMMKFCT
LKAREFGVPIWVSLNPIMVDGTGMCGACRVTVSGQIKFACVDGPEFRGEE
VDWDELLKRLAQYREQEKISYERFLK

3D structure

• PDB: 4yry Insights into Flavin-based Electron Bifurcation via the NADH-dependent Reduced Ferredoxin:NADP Oxidoreductase Structure.
• Chain: A
• Resolution: 2.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FES	A	M218 D220 G221 G223 C225 G226 A227 C228 C240	M218 D220 G221 G223 C225 G226 A227 C228 C240
BS02	FAD	A	F38 E48 P51 L52 T53 V67 V68 K69 V71 G72 T74 T75 N215 P216 M218 Q266	F38 E48 P51 L52 T53 V67 V68 K69 V71 G72 T74 T75 N215 P216 M218 Q266
BS03	NAD	A	K69 G111 G112 V113 G114 G137 A138 R139 V170 V171 V190 G191 P192 I194 M195 M196 F198 S213 N215	K69 G111 G112 V113 G114 G137 A138 R139 V170 V171 V190 G191 P192 I194 M195 M196 F198 S213 N215

Gene Ontology

Molecular Function

• GO:0016491 oxidoreductase activity
• GO:0046872 metal ion binding
• GO:0050660 flavin adenine dinucleotide binding
• GO:0051537 2 iron, 2 sulfur cluster binding

Biological Process

• GO:0006221 pyrimidine nucleotide biosynthetic process

External links

• PDB: RCSB:4yry, PDBe:4yry, PDBj:4yry
• PDBsum: 4yry
• PubMed: 26139605
• UniProt: Q9X1X4|PYRKH_THEMA Dihydroorotate dehydrogenase B (NAD(+)), electron transfer subunit homolog (Gene Name=TM_1639)