Structure of PDB 4yr0 Chain A

Receptor sequence

>4yr0A (length=421) Species: 9606 (Homo sapiens)

PHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGII
AVSYEARAFGVTMSMWADDAKKLCPDLLLAQVRESRGKANLTKYREASVE
VMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLGQPISADLLPSTYIEG
LPQVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERE
TGFQCSAGISHNKVLAKLACGLNKPNRQTLVSHGSVPQLFSQMPIRKIRS
LGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEH
DPVKPRQLPKTIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRN
DNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSHDAFTVIKNCN
TSEWSPPLTMLFLCATKFSAS

3D structure

• PDB: 4yr0 Roles of Residues Arg-61 and Gln-38 of Human DNA Polymerase eta in Bypass of Deoxyguanosine and 7,8-Dihydro-8-oxo-2'-deoxyguanosine.
• Chain: A
• Resolution: 1.78 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	Q38 Y39 W42 W64 K86 R93 R313 P316 K317 T318 G320 S322 K323 N324 P326 R351	Q40 Y41 W44 W66 K88 R95 R306 P309 K310 T311 G313 S315 K316 N317 P319 R344
BS02	dna	A	S113 E116 S257 G259 G260 K261 L262 R377 R382 C384	S115 E118 S250 G252 G253 K254 L255 R370 R375 C377
BS03	DCP	A	D13 D15 C16 F17 F18 Y52 R55 M61 D115 K231	D15 D17 C18 F19 F20 Y54 R57 M63 D117 K224
BS04	CA	A	D13 M14 D115	D15 M16 D117
BS05	CA	A	D13 D115 E116	D15 D117 E118

Gene Ontology

Molecular Function

• GO:0003684 damaged DNA binding

Biological Process

• GO:0006281 DNA repair

External links

• PDB: RCSB:4yr0, PDBe:4yr0, PDBj:4yr0
• PDBsum: 4yr0
• PubMed: 25947374
• UniProt: Q9Y253|POLH_HUMAN DNA polymerase eta (Gene Name=POLH)