Structure of PDB 4yoa Chain A

Receptor sequence

>4yoaA (length=99) Species: 11676 (Human immunodeficiency virus 1)

PQITLWKRPIVTIKIGGQLKEALLNTGADDTVFEEVNLPGRWKPKLIGGI
GGFVKVRQYDQVPIEICGHKVIGTVLVGPTPTNVIGRNLMTQIGCTLNF

3D structure

• PDB: 4yoa The L33F darunavir resistance mutation acts as a molecular anchor reducing the flexibility of the HIV-1 protease 30s and 80s loops.
• Chain: A
• Resolution: 1.697 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): N25 T26 G27
• Catalytic site (residue number reindexed from 1): N25 T26 G27

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	017	A	N25 D29 V84	N25 D29 V84

Gene Ontology

Molecular Function

• GO:0004190 aspartic-type endopeptidase activity

Biological Process

• GO:0006508 proteolysis

External links

• PDB: RCSB:4yoa, PDBe:4yoa, PDBj:4yoa
• PDBsum: 4yoa
• PubMed: 29124158
• UniProt: Q5RTL1